Proteintech, 85826-4-RR, CRIP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CRIP2 (85826-4-RR) by Proteintech is a Recombinant antibody targeting CRIP2 in WB, ELISA applications with reactivity to human, mouse samples 85826-4-RR targets CRIP2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, mouse heart tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CRIP2, also known as CRP2 and ESP1, belongs to the cysteine-rich intestinal protein family (CRIP family). The CRIP family is a subfamily of the highly conserved Lin-1, Isl1, Mec3/double zinc finger protein family that exhibits diverse biological functions. CRIP2 is a cardiac vascular marker, and its expression is detected in cardiac endothelial cells during development and in the adult heart(PMID: 40118853). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6515 Product name: Recombinant human CRIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000434 Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP Predict reactive species Full Name: cysteine-rich protein 2 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC000434 Gene Symbol: CRIP2 Gene ID (NCBI): 1397 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52943 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.