Proteintech, 85828-4-RR, Ctf1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Ctf1 (85828-4-RR) by Proteintech is a Recombinant antibody targeting Ctf1 in WB, ELISA applications with reactivity to mouse, rat samples 85828-4-RR targets Ctf1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, mouse lung tissue, mouse uterus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CTF1 (Cardiotrophin-1) is a member of the interleukin-6 (IL-6) family of cytokines. It is a secreted protein that induces cardiac myocyte hypertrophy in vitro and has been shown to bind and activate the IL-6ST/gp130 receptor. CTF1 plays a crucial role in various physiological and pathological processes, including cardiac function, metabolism, and cancer progression. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2867 Product name: Recombinant Mouse Ctf1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-203 aa of NM_007795.1 Sequence: SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA Predict reactive species Full Name: cardiotrophin 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_007795.1 Gene Symbol: Ctf1 Gene ID (NCBI): 13019 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q60753 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.