Proteintech, 85831-4-RR, CLIC1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CLIC1 (85831-4-RR) by Proteintech is a Recombinant antibody targeting CLIC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85831-4-RR targets CLIC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat spleen tissue, HL-60 cells, C2C12 cells, RAW 264.7 cells, C6 cells, mouse spleen tissue Positive IHC detected in: mouse kidney tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Chloride intracellular channel protein 1 (CLIC1) is a member of the chloride intracellular channel protein family. It plays a crucial role in various cellular processes, including the regulation of chloride ion transport, cell viability, and mitochondrial function. CLIC1 is involved in the formation of membrane-inserted channels that facilitate chloride ion movement, which is essential for maintaining cellular homeostasis and function (PMID: 32116799). Additionally, CLIC1 has been implicated in cancer progression, where it influences cell proliferation, migration, and invasion (PMID: 38027011). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6049 Product name: Recombinant human CLIC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC064527 Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK Predict reactive species Full Name: chloride intracellular channel 1 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-32 kDa GenBank Accession Number: BC064527 Gene Symbol: CLIC1 Gene ID (NCBI): 1192 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00299 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.