Proteintech, 85835-4-RR, MBL Recombinant monoclonal antibody

Size: 20ul / 100ul The MBL (85835-4-RR) by Proteintech is a Recombinant antibody targeting MBL in WB, ELISA applications with reactivity to mouse, rat samples 85835-4-RR targets MBL in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, mouse serum Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3157 Product name: Recombinant Mouse Mbl2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-244 aa of NM_010776.1 Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD Predict reactive species Full Name: mannose-binding lectin (protein C) 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: NM_010776.1 Gene Symbol: Mbl2 Gene ID (NCBI): 17195 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41317 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.