Iright
BRAND / VENDOR: Proteintech

Proteintech, 85859-5-RR, HIC5 Recombinant monoclonal antibody

CATALOG NUMBER: 85859-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HIC5 (85859-5-RR) by Proteintech is a Recombinant antibody targeting HIC5 in WB, ELISA applications with reactivity to human, rat samples 85859-5-RR targets HIC5 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat colon tissue, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HIC5 (Hydrogen Peroxide-Inducible Clone 5), also known as TGFB1I1, ARA55, or TSC-5. It was first identified in 1994 as a gene induced by transforming growth factor-β (TGF-β) or hydrogen peroxide (PMID: 36222304). HIC5 is a member of the Paxillin protein family and functions as a molecular adapter, delivering signals when the cellular adhesion environment changes. Given its role in cancer and fibrotic diseases, HIC5 is a potential therapeutic target. For example, targeting HIC5 or the GR tau2 region could modulate the set of genes regulated by GR, providing opportunities for intervention (PMID: 24591583). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0868 Product name: Recombinant human TGFB1I1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC001830 Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAW Predict reactive species Full Name: transforming growth factor beta 1 induced transcript 1 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC001830 Gene Symbol: HIC5 Gene ID (NCBI): 7041 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43294 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924