Iright
BRAND / VENDOR: Proteintech

Proteintech, 85876-1-RR, MGL2 Recombinant monoclonal antibody

CATALOG NUMBER: 85876-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The MGL2 (85876-1-RR) by Proteintech is a Recombinant antibody targeting MGL2 in WB, ELISA applications with reactivity to mouse samples 85876-1-RR targets MGL2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, Recombinant protein, mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MGL2 is mainly expressed on immature dendritic cell (DCs) , tolerogenic DCs, type 2 DCs, and alternatively activated macrophages. MGL2 protein has carbohydrate-binding activity, specifically recognizing and binding to terminal GalNAc (n-acetyl 2-amino-2-deoxy-D-galactopyranose) residues, including the TN antigen (Galnac- αthrser) . This specific binding makes it play an important role in the recognition and processing of glycosylated pathogens, apoptotic cell fragments and tumor cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2727 Product name: Recombinant Mouse MGL2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 72-332 aa of NM_145137.2 Sequence: SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP Predict reactive species Full Name: macrophage galactose N-acetyl-galactosamine specific lectin 2 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_145137.2 Gene Symbol: Mgl2 Gene ID (NCBI): 216864 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8JZN1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924