Proteintech, 85881-3-RR, CD79A Recombinant monoclonal antibody

Size: 20ul / 100ul The CD79A (85881-3-RR) by Proteintech is a Recombinant antibody targeting CD79A in IHC, ELISA applications with reactivity to mouse samples 85881-3-RR targets CD79A in IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information CD79A, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1388 Product name: Recombinant Mouse CD79A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-137 aa of NM_007655.3 Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR Predict reactive species Full Name: CD79A antigen (immunoglobulin-associated alpha) Calculated Molecular Weight: 25 kDa GenBank Accession Number: NM_007655.3 Gene Symbol: Cd79a Gene ID (NCBI): 12518 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.