Proteintech, 85883-5-RR, LGALS3BP Recombinant monoclonal antibody

Size: 20ul / 100ul The LGALS3BP (85883-5-RR) by Proteintech is a Recombinant antibody targeting LGALS3BP in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 85883-5-RR targets LGALS3BP in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human urine Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3302 Product name: Recombinant Human LGALS3BP protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NM_005567 Sequence: VNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS Predict reactive species Full Name: lectin, galactoside-binding, soluble, 3 binding protein Calculated Molecular Weight: 585 aa, 65 kDa Observed Molecular Weight: 97, 70 kDa GenBank Accession Number: NM_005567 Gene Symbol: LGALS3BP Gene ID (NCBI): 3959 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08380 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.