Proteintech, 85901-1-RR, EPOR Recombinant monoclonal antibody

Size: 20ul / 100ul The EPOR (85901-1-RR) by Proteintech is a Recombinant antibody targeting EPOR in WB, ELISA applications with reactivity to mouse samples 85901-1-RR targets EPOR in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse serum Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). The calculated molecular weight of EPOR is 55 kDa. EPOR undergoes posttranslational modification and the apparent molecular weight of 66-78 kDa has been reported (PMID: 8943308; 12088257). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2711 Product name: Recombinant Mouse Epor protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-249 aa of NM_010149.3 Sequence: APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP Predict reactive species Full Name: erythropoietin receptor Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: NM_010149.3 Gene Symbol: Epor Gene ID (NCBI): 13857 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14753-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.