Proteintech, 85923-1-RR, Neuroserpin Recombinant monoclonal antibody

Size: 20ul / 100ul The Neuroserpin (85923-1-RR) by Proteintech is a Recombinant antibody targeting Neuroserpin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, pig samples 85923-1-RR targets Neuroserpin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, pig brain tissue, mouse cerebellum tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape. Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2819 Product name: Recombinant Human Neuroserpin protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 17-410 aa of NM_005025.4 Sequence: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Predict reactive species Full Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: NM_005025.4 Gene Symbol: Neuroserpin Gene ID (NCBI): 5274 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.