Proteintech, 85939-4-RR, NUMB Recombinant monoclonal antibody

Size: 20ul / 100ul The NUMB (85939-4-RR) by Proteintech is a Recombinant antibody targeting NUMB in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 85939-4-RR targets NUMB in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A-204 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, SKOV-3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information NUMB, also named as S171, plays a role in the determination of cell fates during development. It is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. The degradation of NUMB is induced in a proteasome-dependent manner by MDM2. Four transcript variants encoding different isoforms have been found for this gene. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31553 Product name: Recombinant human NUMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 510-651 aa of NM_001005743 Sequence: SYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL Predict reactive species Full Name: numb homolog (Drosophila) Calculated Molecular Weight: 71KD Observed Molecular Weight: 66-71 kDa GenBank Accession Number: NM_001005743 Gene Symbol: NUMB Gene ID (NCBI): 8650 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.