Proteintech, 85942-1-RR, GRK1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GRK1 (85942-1-RR) by Proteintech is a Recombinant antibody targeting GRK1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 85942-1-RR targets GRK1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, mouse retina tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information GRK1(G protein-coupled receptor kinase 1) is also named as RHOK, RK, GPRK1, and belongs to the AGC Ser/Thr protein kinase family. It is involved in quenching of light-induced signal transduction in the phosphoreceptor. GRK1 is a photoreceptor-specific enzyme that mediates adaptation of photoreceptors to light and protects these cells against light-induced injury. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18063 Product name: Recombinant human GRK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 339-563 aa of BC140945 Sequence: AVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS Predict reactive species Full Name: G protein-coupled receptor kinase 1 Calculated Molecular Weight: 563 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC140945 Gene Symbol: GRK1 Gene ID (NCBI): 6011 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15835 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.