Iright
BRAND / VENDOR: Proteintech

Proteintech, 85946-1-RR, DLX6 Recombinant monoclonal antibody

CATALOG NUMBER: 85946-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DLX6 (85946-1-RR) by Proteintech is a Recombinant antibody targeting DLX6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85946-1-RR targets DLX6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Distal-less homeobox 6 (DLX6) has been reported to play important roles in the development of craniofacial structures, inner ear, limb, and brain. DLX6 was significantly highly expressed in oral cancer tissues in The Cancer Genome Atlas database. DLX6 promotes cell proliferation and suppresses cell apoptosis in oral cancer cells. EGFR-CCND1 pathway might be the potential mechanism participating in the regulating axis (PMID: 33215805). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19724 Product name: Recombinant human DLX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-175 aa of BC069363 Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM Predict reactive species Full Name: distal-less homeobox 6 Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC069363 Gene Symbol: DLX6 Gene ID (NCBI): 1750 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56179 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924