Iright
BRAND / VENDOR: Proteintech

Proteintech, 85949-1-RR, SNAPIN Recombinant monoclonal antibody

CATALOG NUMBER: 85949-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SNAPIN (85949-1-RR) by Proteintech is a Recombinant antibody targeting SNAPIN in WB, ELISA applications with reactivity to human samples 85949-1-RR targets SNAPIN in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A375 cells, SKOV-3 cells, DU 145 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Snapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0101 Product name: Recombinant human SNAPIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC000761 Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK Predict reactive species Full Name: SNAP-associated protein Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15-18 kDa GenBank Accession Number: BC000761 Gene Symbol: SNAPIN Gene ID (NCBI): 23557 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95295 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924