Iright
BRAND / VENDOR: Proteintech

Proteintech, 85978-1-RR, SFXN3 Recombinant monoclonal antibody

CATALOG NUMBER: 85978-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SFXN3 (85978-1-RR) by Proteintech is a Recombinant antibody targeting SFXN3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85978-1-RR targets SFXN3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Recombinant protein, BxPC-3 cells, NIH/3T3 cells, Neuro-2a cells, C6 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SFXN3, a mitochondrial membrane protein, is a member of sideroflexin family. Serum anti-SFXN3 autoantibody was elevated in early stage of the oral squamous cell carcinoma significantly, indicating its clinical value for diagnosis of oral squamous cell carcinoma. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7203 Product name: Recombinant human SFXN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC000124 Sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP Predict reactive species Full Name: sideroflexin 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC000124 Gene Symbol: SFXN3 Gene ID (NCBI): 81855 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BWM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924