Proteintech, 85983-1-RR, PRKG1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PRKG1 (85983-1-RR) by Proteintech is a Recombinant antibody targeting PRKG1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85983-1-RR targets PRKG1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse lung tissue, rat lung tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation (PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells (PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16333 Product name: Recombinant human PRKG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC127090 Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG Predict reactive species Full Name: protein kinase, cGMP-dependent, type I Calculated Molecular Weight: 686 aa, 78 kDa Observed Molecular Weight: 65-78 kDa GenBank Accession Number: BC127090 Gene Symbol: PRKG1 Gene ID (NCBI): 5592 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13976 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.