Proteintech, 85990-2-RR, BRD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The BRD2 (85990-2-RR) by Proteintech is a Recombinant antibody targeting BRD2 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 85990-2-RR targets BRD2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, A549 cells, K-562 cells, C2C12 cells, PC-12 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information BRD2 (Bromodomain-containing protein 2), also known as RING3, is a member of the Bromodomain and Extra-Terminal (BET) family of proteins. These proteins contain two bromodomains and one extra-terminal domain. BRD2 primarily localizes to the nucleus and functions as an atypical protein kinase. Its main role involves the activation of E2F1 and E2F2 proteins, facilitating the production of proteins essential for the G1/S phase transition of the cell cycle. BRD2 specifically recognizes acetylated histones through its bromodomains, particularly acetylated lysine residues on histones H3 and H4. This interaction allows BRD2 to recruit various transcription factors, co-activators, and repressors, thereby modulating transcriptional activity. BRD2 plays a crucial role in chromatin remodeling by recruiting proteins such as histone deacetylases. It is highly expressed during neural tube development and closure, making it essential for neurogenesis and embryogenesis.(PMID: 33462181, PMID: 37926722) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17589 Product name: Recombinant human BRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 537-668 aa of BC063840 Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS Predict reactive species Full Name: bromodomain containing 2 Calculated Molecular Weight: 836 aa, 92 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC063840 Gene Symbol: BRD2 Gene ID (NCBI): 6046 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.