Iright
BRAND / VENDOR: Proteintech

Proteintech, 85992-2-RR, ISG20L2 Recombinant monoclonal antibody

CATALOG NUMBER: 85992-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ISG20L2 (85992-2-RR) by Proteintech is a Recombinant antibody targeting ISG20L2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85992-2-RR targets ISG20L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HEK-293 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ISG20L2, also named HSD38, is a member of a vertebrate exonucleases family. ISG20L2 is composed of at least two functional domains, one at its N-terminal half allowing intracellular localization and association with the binding partners and the other at its C-terminal half bearing the 3` to 5` exoribonuclease activity. The molecular weight of ISG20L2 is 39 kDa (PMID: 18065403). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20026 Product name: Recombinant human ISG20L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC000575 Sequence: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD Predict reactive species Full Name: interferon stimulated exonuclease gene 20kDa-like 2 Calculated Molecular Weight: 353 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC000575 Gene Symbol: ISG20L2 Gene ID (NCBI): 81875 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9L3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924