Proteintech, 86022-1-RR, HSPB8 Recombinant monoclonal antibody

Size: 20ul / 100ul The HSPB8 (86022-1-RR) by Proteintech is a Recombinant antibody targeting HSPB8 in WB, ELISA applications with reactivity to human, mouse, rat samples 86022-1-RR targets HSPB8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, Neuro-2a cells, rat heart tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The Heat Shock Protein B8 (HSPB8), also named small stress protein-like protein (sHSP22), protein kinase H11(H11), E2-induced gene 1 protein (E2IG1), or alpha-crystallin C chain (CRYAC), is a small chaperone involved in chaperone-assisted selective autophagy (CASA) (PMID: 33562660). HSPB8 is expressed at relatively high levels in the heart and the skeletal muscle tissue. HSPB8 is composed of 196 amino acids with an apparent molecular mass of 21.6 kDa (PMID: 20570967). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7456 Product name: Recombinant human HSPB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC002673 Sequence: MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT Predict reactive species Full Name: heat shock 22kDa protein 8 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC002673 Gene Symbol: HSPB8 Gene ID (NCBI): 26353 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UJY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.