Proteintech, 86025-1-RR, CD226 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD226 (86025-1-RR) by Proteintech is a Recombinant antibody targeting CD226 in WB, ELISA applications with reactivity to mouse samples 86025-1-RR targets CD226 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD226 (DNAM-1) is a ~65 kDa glycoprotein expressed on the surface of NK cells, platelets, monocytes, and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. CD226 mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Interactions of CD226 and its ligands, CD155 and CD112, induce NK and T cell-mediated cytotoxicity and cytokine secretion (PMID: 15039383). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1588 Product name: Recombinant Mouse CD226 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-254 aa of NM_178687.2 Sequence: EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP Predict reactive species Full Name: CD226 antigen Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: NM_178687.2 Gene Symbol: Cd226 Gene ID (NCBI): 225825 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8K4F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.