Proteintech, 86034-1-RR, DIS3L2 Recombinant monoclonal antibody

Size: 20ul / 100ul The DIS3L2 (86034-1-RR) by Proteintech is a Recombinant antibody targeting DIS3L2 in WB, ELISA applications with reactivity to human samples 86034-1-RR targets DIS3L2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, A2780 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30634 Product name: Recombinant human DIS3L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-201 aa of BC036113 Sequence: VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG Predict reactive species Full Name: DIS3 mitotic control homolog (S. cerevisiae)-like 2 Observed Molecular Weight: 99 kDa GenBank Accession Number: BC036113 Gene Symbol: DIS3L2 Gene ID (NCBI): 129563 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IYB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.