Proteintech, 86044-1-RR, iASPP Recombinant monoclonal antibody

Size: 20ul / 100ul The iASPP (86044-1-RR) by Proteintech is a Recombinant antibody targeting iASPP in WB, ELISA applications with reactivity to human, mouse samples 86044-1-RR targets iASPP in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, PC-3 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Inhibitor of apoptosis-stimulating protein of p53 (iASPP), encoded by PPP1R13L gene, is often overexpressed in human cancers. The ASPP family includes three members, namely ASPP1, ASPP2, and iASPP, which are specific regulators of p53-, p63-, and p73-mediated apoptosis. ASPP1 and ASPP2 enhance the apoptotic function of p53, whereas iASPP specifically inhibits p53-mediated apoptosis. Overexpression of iASPP is associated with resistance to cisplatin-induced apoptosis and rediation therapy. iASPP plays a pivotal role in regulating cancer cell proliferation and tumor progression. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13273 Product name: Recombinant human PPP1R13L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-829 aa of BC064913 Sequence: EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 13 like Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC064913 Gene Symbol: PPP1R13L Gene ID (NCBI): 10848 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WUF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.