Proteintech, 86056-1-RR, GYG1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GYG1 (86056-1-RR) by Proteintech is a Recombinant antibody targeting GYG1 in WB, ELISA applications with reactivity to human samples 86056-1-RR targets GYG1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The GYG1 gene encodes glycogenin-1, a core protein in muscle glycogen particles. GYG1 is a glycosyltransferase that forms a short glucose polymer of approximately 10 glucose residues by autoglucosylation (PMID: 25272951 ). Cardiomyopathy and muscle weakness associated with muscle glycogen depletion can also be caused by impaired priming of glycogen synthesis due to inactivation of muscle glycogenin (glycogenin-1) (PMID: 20357282). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3583 Product name: Recombinant human GYG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC031096 Sequence: DQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ Predict reactive species Full Name: glycogenin 1 Calculated Molecular Weight: 350 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC031096 Gene Symbol: GYG1 Gene ID (NCBI): 2992 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46976 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.