Proteintech, 86063-2-RR, CD8a Recombinant monoclonal antibody

Size: 20ul / 100ul The CD8a (86063-2-RR) by Proteintech is a Recombinant antibody targeting CD8a in IHC, IF/ICC, ELISA applications with reactivity to human samples 86063-2-RR targets CD8a in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human ovary cancer tissue, human stomach cancer tissue, human rectal cancer tissue, human hepatocellular cancer, human breast cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 22-182 aa of human CD8a, the alpha chain of CD8 molecule. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0819 Product name: Recombinant Human CD8a protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-182 aa of NM_001145873.1 Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Predict reactive species Full Name: CD8a molecule Calculated Molecular Weight: 26 kDa GenBank Accession Number: NM_001145873.1 Gene Symbol: CD8A Gene ID (NCBI): 925 ENSEMBL Gene ID: ENSG00000153563 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01732-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.