Product Description
Size: 20ul / 100ul
The PCNP (86075-1-RR) by Proteintech is a Recombinant antibody targeting PCNP in WB, IF/ICC, ELISA applications with reactivity to human samples
86075-1-RR targets PCNP in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, Jurkat cells, Raji cells
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag30951 Product name: Recombinant human PCNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI Predict reactive species
Full Name: PEST proteolytic signal containing nuclear protein
Calculated Molecular Weight: 19 kDa
Observed Molecular Weight: 24-28 kDa
GenBank Accession Number: BC013916
Gene Symbol: PCNP
Gene ID (NCBI): 57092
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q8WW12
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924