Iright
BRAND / VENDOR: Proteintech

Proteintech, 86143-1-RR, Klk1 Recombinant monoclonal antibody

CATALOG NUMBER: 86143-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Klk1 (86143-1-RR) by Proteintech is a Recombinant antibody targeting Klk1 in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples 86143-1-RR targets Klk1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Mouse KLK1 (Kallikrein-Related Peptidase 1) is a serine protease belonging to the kallikrein family with important physiological functions. KLK1 can cleave the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Bradykinin plays an important role in regulating vasodilation, lowering blood pressure, smooth muscle relaxation and contraction, pain induction and inflammatory response. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2996 Product name: recombinant mouse Klk1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-261 aa of NM_001320331.1 Sequence: PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND Predict reactive species Full Name: kallikrein 1 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 28-34 kDa GenBank Accession Number: NM_001320331.1 Gene Symbol: Klk1 Gene ID (NCBI): 16612 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15947 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924