Iright
BRAND / VENDOR: Proteintech

Proteintech, 86146-1-RR, ALOX15B Recombinant monoclonal antibody

CATALOG NUMBER: 86146-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ALOX15B (86146-1-RR) by Proteintech is a Recombinant antibody targeting ALOX15B in WB, ELISA applications with reactivity to human samples 86146-1-RR targets ALOX15B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HL-60 cells, A431 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information In humans, there are 6 functional lipoxygenases genes. Two of them encode for arachidonic acid 12-lipoxygenating (ALOX12, ALOX12B) and two for 15-lipoxygenating enzymes (ALOX15, ALOX15B). ALOX15B has been described as the most abundant 15-lipoxygenating enzyme species in human carotid atherosclerotic lesions and to be associated with cerebrovascular symptoms. (PMID:24373925). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3741 Product name: Recombinant human ALOX15B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC035217 Sequence: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKW Predict reactive species Full Name: arachidonate 15-lipoxygenase, type B Calculated Molecular Weight: 676 aa, 76 kDa Observed Molecular Weight: 67-75 kDa GenBank Accession Number: BC035217 Gene Symbol: ALOX15B Gene ID (NCBI): 247 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924