Proteintech, 86192-3-RR, Myogenin Recombinant monoclonal antibody

Size: 20ul / 100ul The Myogenin (86192-3-RR) by Proteintech is a Recombinant antibody targeting Myogenin in WB, ELISA applications with reactivity to human, mouse, rat samples 86192-3-RR targets Myogenin in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A-204 cells, C2C12 cells, mouse heart tissue, rat heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25081 Product name: Recombinant human Myogenin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-224 aa of BC053899 Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN Predict reactive species Full Name: myogenin (myogenic factor 4) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC053899 Gene Symbol: Myogenin Gene ID (NCBI): 4656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15173 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.