Iright
BRAND / VENDOR: Proteintech

Proteintech, 86204-1-RR, ACY1 Recombinant monoclonal antibody

CATALOG NUMBER: 86204-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ACY1 (86204-1-RR) by Proteintech is a Recombinant antibody targeting ACY1 in WB, ELISA applications with reactivity to human, mouse, rat samples 86204-1-RR targets ACY1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, PC-3 cells, Neuro-2a cells, NIH/3T3 cells, PC-12 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Aminoacylase 1 (ACY1) is a cytosolic enzyme that is widely distributed in mammalian tissues and catalyzes the hydrolysis of acylated amino acids into amino acids and acyl groups. The main functions of ACY1 are to accelerate the hydrolysis of N-acetylated peptides, especially N-acetylated neutral aliphatic amino acids, and participate in protein synthesis and turnover through the release of free amino acids. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1813 Product name: Recombinant human ACY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-408 aa of BC014112 Sequence: RGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS Predict reactive species Full Name: aminoacylase 1 Calculated Molecular Weight: 40.8 kDa GenBank Accession Number: BC014112 Gene Symbol: ACY1 Gene ID (NCBI): 95 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03154 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924