Proteintech, 86207-1-RR, DKK1 Recombinant monoclonal antibody

Size: 20ul / 100ul The DKK1 (86207-1-RR) by Proteintech is a Recombinant antibody targeting DKK1 in WB, ELISA applications with reactivity to mouse, rat samples 86207-1-RR targets DKK1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information DKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4649 Product name: Recombinant Mouse DKK1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 32-272 aa of NM_010051.3 Sequence: TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH Predict reactive species Full Name: dickkopf homolog 1 (Xenopus laevis) Calculated Molecular Weight: 29kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: NM_010051.3 Gene Symbol: Dkk1 Gene ID (NCBI): 13380 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O54908 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.