Iright
BRAND / VENDOR: Proteintech

Proteintech, 86209-1-RR, PGM2L1 Recombinant monoclonal antibody

CATALOG NUMBER: 86209-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PGM2L1 (86209-1-RR) by Proteintech is a Recombinant antibody targeting PGM2L1 in WB, ELISA applications with reactivity to human, mouse, rat samples 86209-1-RR targets PGM2L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, U-251 cells, A549 cells, mouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PGM2L1 (Phosphoglucomutase 2 Like 1) is an enzyme-like protein involved in carbohydrate metabolism. PGM2L1 catalyzes the formation of G16BP by using the glycolytic intermediate 1,3-bisphosphoglycerate as a phosphate donor and glucose-1-phosphate or glucose-6-phosphate as a phosphate acceptor. PGM2L1 plays a crucial role in glycogen metabolism, glycolysis, and gluconeogenesis as a key enzyme, and increasing evidence links its function to cancer metabolism and progression. While PGM2 has a wide tissue distribution, PGM2L1 is highly expressed in the brain, accounting for the elevated concentrations of glucose-1,6-bisphosphate found there (PMID: 33979636, PMID: 40027181). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5019 Product name: Recombinant human PGM2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-622 aa of BC059360 Sequence: GHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV Predict reactive species Full Name: phosphoglucomutase 2-like 1 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC059360 Gene Symbol: PGM2L1 Gene ID (NCBI): 283209 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6PCE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924