Iright
BRAND / VENDOR: Proteintech

Proteintech, 86237-1-RR, PSMC1 Recombinant monoclonal antibody

CATALOG NUMBER: 86237-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PSMC1 (86237-1-RR) by Proteintech is a Recombinant antibody targeting PSMC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86237-1-RR targets PSMC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue, mouse lung tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1677 Product name: Recombinant human PSMC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-440 aa of BC016368 Sequence: EFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNRAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, ATPase, 1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC016368 Gene Symbol: PSMC1 Gene ID (NCBI): 5700 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P62191 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924