Proteintech, 86245-1-RR, CYBRD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CYBRD1 (86245-1-RR) by Proteintech is a Recombinant antibody targeting CYBRD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 86245-1-RR targets CYBRD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: T-47D cells, mouse colon tissue, rat colon tissue, COLO 320 cells, SW480 cells, HCT 116 cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CYBRD1, also known as Cytochrome b Reductase 1, is a gene encoding a key enzyme involved in iron metabolism. It functions primarily in duodenal enterocytes, where it reduces dietary ferric iron (Fe³⁺) to the more soluble ferrous form (Fe²⁺) at the brush border membrane. This reduction step is crucial for the subsequent uptake of iron into the body via the divalent metal transporter 1 (DMT1). CYBRD1's activity is therefore essential for maintaining systemic iron homeostasis, and its expression is regulated by body iron stores and hypoxia. Dysregulation of this gene has been implicated in disorders of iron overload, such as hereditary hemochromatosis, highlighting its significant role in human iron physiology. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24968 Product name: Recombinant human CYBRD1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 148-286 aa of BC065290 Sequence: PLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM Predict reactive species Full Name: cytochrome b reductase 1 Observed Molecular Weight: 25-31 kDa GenBank Accession Number: BC065290 Gene Symbol: CYBRD1 Gene ID (NCBI): 79901 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q53TN4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.