Iright
BRAND / VENDOR: Proteintech

Proteintech, 86264-1-RR, Armetl1 Recombinant monoclonal antibody

CATALOG NUMBER: 86264-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Armetl1 (86264-1-RR) by Proteintech is a Recombinant antibody targeting Armetl1 in WB, ELISA applications with reactivity to mouse samples 86264-1-RR targets Armetl1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse testis tissue,mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2845 Product name: Recombinant Mouse ARMETL1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-187 aa of NM_177647.4 Sequence: LEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL Predict reactive species Full Name: arginine-rich, mutated in early stage tumors-like 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 16-21 kDa GenBank Accession Number: NM_177647.4 Gene Symbol: Armetl1 Gene ID (NCBI): 227526 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8CC36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924