Proteintech, 86296-3-RR, CDK12/CRKRS Recombinant monoclonal antibody

Size: 20ul / 100ul The CDK12/CRKRS (86296-3-RR) by Proteintech is a Recombinant antibody targeting CDK12/CRKRS in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86296-3-RR targets CDK12/CRKRS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, HEK-293T cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information CRKRS (Cdc2-related kinase, Arg/Ser), also named as cyclin-dependent kinase 12 (CKD12), belongs to CDC2/CDKX subfamily. CDK12 can form a heterodimeric complex with its activating partner, cyclin K, to regulate important cellular physiological processes that include transcriptional regulation, regulation of DNA damage repair genes such as BRCA1 and ATM, suppression of intronic polyadenylation, and susceptibility to PARP inhibitors (PMID: 30487607, 24240700, 31694772). CDK12 has 3 isoforms with the calculated molecular mass of 164/163/141 kDa, and the apparent molecular mass of 180-200 kDa due to some modifications (PMID 11683387, 22988298). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25312 Product name: Recombinant human CRKRS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1300-1481 aa of BC150265 Sequence: EAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY Predict reactive species Full Name: Cdc2-related kinase, arginine/serine-rich Calculated Molecular Weight: 1490 aa, 164 kDa Observed Molecular Weight: 180-200 kDa GenBank Accession Number: BC150265 Gene Symbol: CDK12 Gene ID (NCBI): 51755 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NYV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.