Proteintech, 86327-1-RR, CD39/ENTPD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD39/ENTPD1 (86327-1-RR) by Proteintech is a Recombinant antibody targeting CD39/ENTPD1 in WB, ELISA applications with reactivity to mouse samples 86327-1-RR targets CD39/ENTPD1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse lung tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ENTPD1 (Ectonucleoside triphosphate diphosphohydrolase 1) is also named CD39, NTPDase 1, and Ecto-ATPDase 1 and belongs to the GDA1/CD39 NTPase family. In the nervous system, it can hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. It is a noncovalent tetrameric protein and detergent inhibition of enzymatic activity is caused by dissociation of ectoapyrase tetramers into monomers(PMID: 9733785 ). And it is a 70- to 100-kDa protein that is heavily N-glycosylated (PMID:7930580). This protein has 6 glycosylation sites and 3 isoforms (58 kDa, 59 kDa, and 34 kDa) produced by alternative splicing. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3483 Product name: recombinant mouse CD39 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 38-478 aa of NM_009848.4 Sequence: TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI Predict reactive species Full Name: ectonucleoside triphosphate diphosphohydrolase 1 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_009848.4 Gene Symbol: Entpd1 Gene ID (NCBI): 12495 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55772 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.