Iright
BRAND / VENDOR: Proteintech

Proteintech, 86334-2-RR, HSD17B4 Recombinant monoclonal antibody

CATALOG NUMBER: 86334-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HSD17B4 (86334-2-RR) by Proteintech is a Recombinant antibody targeting HSD17B4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86334-2-RR targets HSD17B4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, HepG2 cells, mouse liver tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information HSD17B4 (17-beta-hydroxysteroid dehydrogenase 4) is also named as Peroxisomal multifunctional enzyme type 2, D-bifuntional protein or multifunctional protein 2. It codes for a 80 kDa enzyme containing three distinct functional domains and is localized in peroxisomes. It is a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids and catalyzing the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-brancked-chian fatty acids. After peroxisomal import, the full-length protein is proteolytically cleaved to yield a 35-kDa dehydrogenase subunit and a 45-kDa hydratase subunit containing the hydratase and SCP domains (PMID: 28868548, 24602372). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7165 Product name: Recombinant human HSD17B4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 436-736 aa of BC003098 Sequence: GSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 4 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 75 kDa, 45 kDa GenBank Accession Number: BC003098 Gene Symbol: HSD17B4 Gene ID (NCBI): 3295 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51659 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924