Proteintech, 86337-2-RR, CD107a / LAMP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD107a / LAMP1 (86337-2-RR) by Proteintech is a Recombinant antibody targeting CD107a / LAMP1 in WB, IF/ICC, IF-P, ELISA applications with reactivity to mouse samples 86337-2-RR targets CD107a / LAMP1 in WB, IF/ICC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells, NIH/3T3 cells, EL-4 cells, mouse thymus tissue, mouse small intestine cells Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: C2C12 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information LAMP1 (CD107a) is a heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP1 is expressed largely in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane (PMID: 16168398). Elevated LAMP1 expression at the cell surface has also been detected during platelet and granulocytic cell activation, as well as in some tumor cells (PMID: 29085473). LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis (PMID: 18835598; 29085473; 9426697). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3858 Product name: Recombinant Mouse LAMP-1/CD107a protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-370 aa of NM_010684.3 Sequence: LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN Predict reactive species Full Name: lysosomal-associated membrane protein 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 90-120 kDa GenBank Accession Number: NM_010684.3 Gene Symbol: CD107a Gene ID (NCBI): 16783 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11438 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.