Iright
BRAND / VENDOR: Proteintech

Proteintech, 86343-2-RR, PTRH2 Recombinant monoclonal antibody

CATALOG NUMBER: 86343-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PTRH2 (86343-2-RR) by Proteintech is a Recombinant antibody targeting PTRH2 in WB, ELISA applications with reactivity to human samples 86343-2-RR targets PTRH2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, Raji cells, MCF-7 cells, Jurkat cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PTRH2 (Peptidyl-tRNA Hydrolase 2, also known as Bcl-2 Inhibitor of Transcription 1 or BIT1) is a highly conserved protein that plays crucial roles in various cellular processes, including protein synthesis, cell survival, and cell death. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0839 Product name: Recombinant human PTRH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC006807 Sequence: MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY Predict reactive species Full Name: peptidyl-tRNA hydrolase 2 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC006807 Gene Symbol: PTRH2 Gene ID (NCBI): 51651 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y3E5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924