Product Description
Size: 20ul / 100ul
The DAZL (86344-3-RR) by Proteintech is a Recombinant antibody targeting DAZL in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples
86344-3-RR targets DAZL in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue
Positive IP detected in: mouse testis tissue
Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Immunofluorescence (IF)-P: IF-P : 1:1000-1:4000
Background Information
DAZL proteins are germ cell-specific RNA-binding proteins and are considered major regulators of spermatogenesis. Because DAZL is a novel protein expressed specifically in germ cells, it is widely employed as a germ cell marker. In humans, immunostaining shows DAZL is abundant in the cytoplasm of primary spermatocytes, but scarce in spermatogonia.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag37074 Product name: Recombinant human DAZL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-295 aa of BC027595 Sequence: QRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV Predict reactive species
Full Name: deleted in azoospermia-like
Calculated Molecular Weight: 295 aa, 33 kDa
Observed Molecular Weight: 37 kDa
GenBank Accession Number: BC027595
Gene Symbol: DAZL
Gene ID (NCBI): 1618
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q92904
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924