Iright
BRAND / VENDOR: Proteintech

Proteintech, 86371-1-RR, NR2F6 Recombinant monoclonal antibody

CATALOG NUMBER: 86371-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NR2F6 (86371-1-RR) by Proteintech is a Recombinant antibody targeting NR2F6 in WB, IF/ICC, ELISA applications with reactivity to human samples 86371-1-RR targets NR2F6 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells Positive IF/ICC detected in: HeLa cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information NR2F6 belongs to NR2F subfamily members, which have their roles in the regulation of neurogenesis, organogenesis, and cellular differentiation during embryonic development (PMID:15875024). NR2F6 acts as transcription factor by binding to a TGACCT direct-repeat motif and has been established in controlling facets of central nervous system (CNS) (PMID: 12690040). It is a nuclear attenuator that directly interferes with DNA binding of NF-AT and, subsequently, transcriptional activity of the NF-AT-dependent IL-17 expression. Otherwise, NR2F6 negatively interfered with transcriptional cytokine responses and acted as a barrier against autoimmunity (PMID:18701084). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7614 Product name: Recombinant human NR2F6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC002669 Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ Predict reactive species Full Name: nuclear receptor subfamily 2, group F, member 6 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC002669 Gene Symbol: NR2F6 Gene ID (NCBI): 2063 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10588 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924