Iright
BRAND / VENDOR: Proteintech

Proteintech, 86394-1-RR, COQ7 Recombinant monoclonal antibody

CATALOG NUMBER: 86394-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The COQ7 (86394-1-RR) by Proteintech is a Recombinant antibody targeting COQ7 in WB, ELISA applications with reactivity to human, mouse, rat samples 86394-1-RR targets COQ7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HL-60 cells, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information COQ7(Ubiquinone biosynthesis protein COQ7 homolog) catalyzes the production of coenzyme Q (CoQ) in mitochondria. The predicted protein contains 179 amino acids, is mostly helical, and contains an alpha-helical membrane insertion. It has a potential N-glycosylation site, a phosphorylation site for protein kinase C and another for casein kinase II, and 3 N-myristoylation sites. This protein has 2 isoforms produced by alternative splicing with MW 20-24 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7161 Product name: Recombinant human COQ7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003185 Sequence: MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL Predict reactive species Full Name: coenzyme Q7 homolog, ubiquinone (yeast) Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 20~24 kDa GenBank Accession Number: BC003185 Gene Symbol: COQ7 Gene ID (NCBI): 10229 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99807 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924