Iright
BRAND / VENDOR: Proteintech

Proteintech, 86395-3-RR, Hemopexin Recombinant monoclonal antibody

CATALOG NUMBER: 86395-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Hemopexin (86395-3-RR) by Proteintech is a Recombinant antibody targeting Hemopexin in WB, FC (Intra), ELISA applications with reactivity to human samples 86395-3-RR targets Hemopexin in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, human plasma Positive FC (Intra) detected in: Transfected CHO Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Hemopexin (HPX) is the plasma protein responsible for scavenging heme, thus preventing heme-mediated oxidative stress and heme-bound iron loss. In addition, hemopexin blocks heme activation of immune receptors and vascular inflammatory processes. It is mainly expressed in liver, the synthesis of which is induced after inflammation. Alterations of plasma hemopexin level have been linked to disorders like atherosclerosis and inflammatory diseases. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3082 Product name: Recombinant Human Hemopexin/HPX protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-462 aa of NM_000613.2 Sequence: TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH Predict reactive species Full Name: hemopexin Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 65-75 kDa GenBank Accession Number: NM_000613.2 Gene Symbol: Hemopexin Gene ID (NCBI): 3263 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02790 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924