Iright
BRAND / VENDOR: Proteintech

Proteintech, 86405-1-RR, PGCP Recombinant monoclonal antibody

CATALOG NUMBER: 86405-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PGCP (86405-1-RR) by Proteintech is a Recombinant antibody targeting PGCP in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 86405-1-RR targets PGCP in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat kidney tissue Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PGCP(plasma glutamate carboxypeptidase) is also named as LCH1,CPQ and belongs to the peptidase M28 family. It may play an important role in the hydrolysis of circulating peptides. It catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. It is a proteinase that acts on the unsubstituted N- and C-termini of dipeptides. It has been suggested that this PGCP is involved in the release of thyroxine(PMID:20951214). Human PGCP is a metallopeptidase with five potential glycosylation sites, whose activity depends on dimerizationand it can be detected a band of 65-72kd in FRTL-5 cells which is pro-PGCP(PMID:22127294). It can be N-glycosylated(PMID:10206990). It has the pro-form of 60-65 kDa and mature form of 55 kDa(PMID:20951214). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9770 Product name: Recombinant human PGCP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-472 aa of BC020689 Sequence: LEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS Predict reactive species Full Name: plasma glutamate carboxypeptidase Calculated Molecular Weight: 472 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC020689 Gene Symbol: PGCP Gene ID (NCBI): 10404 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924