Iright
BRAND / VENDOR: Proteintech

Proteintech, 86426-2-RR, FGL1 Recombinant monoclonal antibody

CATALOG NUMBER: 86426-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The FGL1 (86426-2-RR) by Proteintech is a Recombinant antibody targeting FGL1 in WB, ELISA applications with reactivity to human samples 86426-2-RR targets FGL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, HepG2 cells, HCT 116 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FGL1 is a 68 kDa protein that comprises two disulfide linked 34 kDa homodimers. FGL1 is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2765 Product name: Recombinant Human FGL1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-312 aa of NM_004467.4 Sequence: LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI Predict reactive species Full Name: fibrinogen-like 1 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: NM_004467.4 Gene Symbol: FGL1 Gene ID (NCBI): 2267 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924