Proteintech, 86428-3-RR, GSTA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The GSTA2 (86428-3-RR) by Proteintech is a Recombinant antibody targeting GSTA2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86428-3-RR targets GSTA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, rat testis tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0781 Product name: Recombinant human GSTA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC002895 Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF Predict reactive species Full Name: glutathione S-transferase alpha 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC002895 Gene Symbol: GSTA2 Gene ID (NCBI): 2939 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.