Proteintech, 86437-1-RR, XCL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The XCL1 (86437-1-RR) by Proteintech is a Recombinant antibody targeting XCL1 in WB, ELISA applications with reactivity to human samples 86437-1-RR targets XCL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA, Ionomycin and Brefeldin A treated NK-92 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Background Information XCL1 also known as Lymphotactin, is a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2933 Product name: Recombinant Human XCL1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-114 aa of NM_002995.2 Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Predict reactive species Full Name: chemokine (C motif) ligand 1 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_002995.2 Gene Symbol: XCL1 Gene ID (NCBI): 6375 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P47992 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.