Iright
BRAND / VENDOR: Proteintech

Proteintech, 86450-3-RR, ARD1A Recombinant monoclonal antibody

CATALOG NUMBER: 86450-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ARD1A (86450-3-RR) by Proteintech is a Recombinant antibody targeting ARD1A in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86450-3-RR targets ARD1A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HL-60 cells, MCF-7 cells, NIH/3T3 cells, C2C12 cells, rat spleen tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6519 Product name: Recombinant human ARD1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC000308 Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS Predict reactive species Full Name: ARD1 homolog A, N-acetyltransferase (S. cerevisiae) Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC000308 Gene Symbol: ARD1A Gene ID (NCBI): 8260 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41227 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924