Product Description
Size: 20ul / 100ul
The FOXK1 (86452-1-RR) by Proteintech is a Recombinant antibody targeting FOXK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
86452-1-RR targets FOXK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, HeLa cells, HEK-293T cells, Jurkat cells, K-562 cells, NIH/3T3 cells, PC-12 cells
Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Background Information
Forkhead box (FOX) domains bind DNA and consist of 2 loops connecting beta-sheets that flank an alpha-helix, which is a group of highly conserved transcription factors. Forkhead box k1 (FOXK1) also known as MNF, is a transcription factor that belongs to the forkhead family consisting of the winged-helix DNA-binding domain and the N-terminal and C-terminal transcriptional domains(PMID: 15289879, PMID: 27223064). There are two isoforms of FoxK1: FoxK1-α and FoxK1-β. FoxK1-α (90 kDa) is expressed in committed myoblasts and differentiated myotubes, while FoxK1-β (55 kDa) is expressed mainly in quiescent satellite cells(PMID: 9271401).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag28820 Product name: Recombinant human FOXK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001037165 Sequence: MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ Predict reactive species
Full Name: forkhead box K1
Calculated Molecular Weight: 75 kDa
Observed Molecular Weight: 90-100 kDa
GenBank Accession Number: NM_001037165
Gene Symbol: FOXK1
Gene ID (NCBI): 221937
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P85037
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924