Iright
BRAND / VENDOR: Proteintech

Proteintech, 86469-1-RR, GNB2 Recombinant monoclonal antibody

CATALOG NUMBER: 86469-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GNB2 (86469-1-RR) by Proteintech is a Recombinant antibody targeting GNB2 in WB, ELISA applications with reactivity to human, mouse samples 86469-1-RR targets GNB2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, ACHN cells, BxPC-3 cells, MCF-7 cells, NIH/3T3 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GNB2(Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2) is also named as G protein subunit beta-2, transducin beta chain 2 and belongs to the WD repeat G protein beta family. G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9125 Product name: Recombinant human GNB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC010073 Sequence: MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 2 Calculated Molecular Weight: 340 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC010073 Gene Symbol: GNB2 Gene ID (NCBI): 2783 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P62879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924